(data stored in ACNUC7421 zone)

EMBL: CP001349.PE555

CP001349.PE555       Location/Qualifiers
FT   CDS             complement(634406..635434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0570"
FT                   /product="late control D family protein"
FT                   /note="PFAM: late control D family protein; KEGG:
FT                   met:M446_4124 late control D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55607"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN5"
FT                   /inference="protein motif:PFAM:PF05954"
FT                   /protein_id="ACL55607.1"
FT                   /translation="MSLATSWRVLVNGLDASDRMNPYIESIETTDNAGGKSDSASIVFD
FT                   DTDGQVKLPTKGDPVEIELEGVSVFKGVVDSAESSAARGSGMQLTVSCKSVDKRGKVKE
FT                   RLHKHKDDATLEDFLKDAAKAAGLKDVKVDKSFASIKRPYWSTDGRTFLQLGQELAEEL
FT                   GATFKIQGDTAVFAKRGQGGTPGGGTMPTVRAIRRQNLVSWRITPKETRPRYAKARVRW
FT                   YDRKEAKWKQEDVEIGNAPGAPEVLDLPAAPRATQDHAKDAGKGRKTESEREGGSGEVT
FT                   LLLAVEARAEGTCEVIGTRPGVDGSYRIESVTHKVSRSGAETTLSIKQPQGSAGSDDRS
FT                   AE"
     MSLATSWRVL VNGLDASDRM NPYIESIETT DNAGGKSDSA SIVFDDTDGQ VKLPTKGDPV        60
     EIELEGVSVF KGVVDSAESS AARGSGMQLT VSCKSVDKRG KVKERLHKHK DDATLEDFLK       120
     DAAKAAGLKD VKVDKSFASI KRPYWSTDGR TFLQLGQELA EELGATFKIQ GDTAVFAKRG       180
     QGGTPGGGTM PTVRAIRRQN LVSWRITPKE TRPRYAKARV RWYDRKEAKW KQEDVEIGNA       240
     PGAPEVLDLP AAPRATQDHA KDAGKGRKTE SEREGGSGEV TLLLAVEARA EGTCEVIGTR       300
     PGVDGSYRIE SVTHKVSRSG AETTLSIKQP QGSAGSDDRS AE                          342
//

If you have problems or comments...

PBIL Back to PBIL home page