(data stored in ACNUC7421 zone)

EMBL: CP001349.PE556

CP001349.PE556       Location/Qualifiers
FT   CDS             complement(635447..635674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0571"
FT                   /product="tail X family protein"
FT                   /note="PFAM: tail X family protein; KEGG: met:M446_4125
FT                   tail X family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55608"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN6"
FT                   /inference="protein motif:PFAM:PF05489"
FT                   /protein_id="ACL55608.1"
FT                   /translation="MPLTVIVQDRYAVLDLLLWRAYGRAGNTAAMLSAALKLNPGLAAL
FT                   GPEIPLLTRVILPDLPTTKPTTRKVVSLFD"
     MPLTVIVQDR YAVLDLLLWR AYGRAGNTAA MLSAALKLNP GLAALGPEIP LLTRVILPDL        60
     PTTKPTTRKV VSLFD                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page