(data stored in ACNUC7421 zone)

EMBL: CP001349.PE557

CP001349.PE557       Location/Qualifiers
FT   CDS             complement(635679..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0572"
FT                   /product="P2 GpU family protein"
FT                   /note="KEGG: met:M446_4126 P2 GpU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55609"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN7"
FT                   /inference="similar to AA sequence:KEGG:M446_4126"
FT                   /protein_id="ACL55609.1"
FT                   /translation="MQYSVGVLTFDTFPFSVTGAEREDGEDYAKHDLLNRRRGYEHEGP
FT                   ADDVLTLSGEFLPFHIGGMSELELARDLKNSGSPQYVMRGDGYALGWYVITSIKDSHAD
FT                   AIAPDGVAYKVKYEIKLERVDDPGEDAGAGLIASLVASLFG"
     MQYSVGVLTF DTFPFSVTGA EREDGEDYAK HDLLNRRRGY EHEGPADDVL TLSGEFLPFH        60
     IGGMSELELA RDLKNSGSPQ YVMRGDGYAL GWYVITSIKD SHADAIAPDG VAYKVKYEIK       120
     LERVDDPGED AGAGLIASLV ASLFG                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page