(data stored in ACNUC7421 zone)

EMBL: CP001349.PE558

CP001349.PE558       Location/Qualifiers
FT   CDS             complement(636135..640766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0573"
FT                   /product="TP901 family phage tail tape measure protein"
FT                   /note="KEGG: met:M446_4127 TP901 family phage tail tape
FT                   measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55610"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN8"
FT                   /inference="similar to AA sequence:KEGG:M446_4127"
FT                   /protein_id="ACL55610.1"
FT                   /translation="MVSKTASLIIRLTDDVSGPAGKAAQALKGLSTAGDGLSRLKNAAS
FT                   GLDQLGAKMRQAKIEVERAGKELAAAEKRVAFFRASRERGSHNYPAFEASGLVAEAEAR
FT                   LKAAKRAHAAAERQMAATRAIFVDQKRTVASLTASLSAASGGLKDLRSAETNVAGAAAQ
FT                   TTGALSRQTGVLSSVAGGARTAARAYRDLAAGMSEAGRKALATVEANRRLVEGMSAPAR
FT                   AAAAAAEAHRKAAMQGRADRAASRREALETIGAGAGLIAAHRGKAIGLQAVQSAASMDY
FT                   ATRYQHVATDVSEEDQRRLLIPQAKRIGQETKFSNEDIVHAQTATMQGLPFKDPALKAR
FT                   VGEALVDQARHYAVIMQSDMTRASEGIRSFLQNTNKDISTPEKSLAEAQRGTNLIVKMA
FT                   KLGGMSDEDAQQFIKFGFPTGTQAGLSDVTLAALGASGRRAGLRGDELGVFARAMASKL
FT                   VAPTSKGLDALTAAGIHYNRYTTMPGGLNVDNLEAFSKRRFGKGFTEDQRTRLADLLEN
FT                   SEVVGERDEFTKQVSAIVAEGFGKGKSGKTKAQDVQKIAKMVGDFHKLSVESVDTEGLL
FT                   RAIFSNPKMTAALLNAFFTDKHGGKAGMIAPKMAQFNQDVEELKKIGEDPLFAERKSKY
FT                   MTQGLGGSIDNLKGSFETMVLSIGQANEGLIRFAADGLAKGTDLFSNLSQTQQQILSLV
FT                   GGGAAVAGGVWGTATLMKNLLGFGASAQALTGSAGLLSKSALELSAAAATLGGKGVLPE
FT                   VAKTAAPVAAGAAGVTAGAIAGAVAAGVGTAALVYAAGGRYQPEEVVRMRDELSELNKR
FT                   LERQNESVYRQQSQGDDATAEIARRDATLARIKELTAALEKAATAQGTETKGEEGPRAG
FT                   LKLSEAAREALDARKAGAAVQAPPETVSAPAPSVRPPEVSGVTDAATKAGGEAPKPAEG
FT                   ASQAAPAAAPVMAPTVRAPAPPARPPELGQAPAPLPPARSPEMGLPPDHAAAIQAATSA
FT                   LATYRAELAGIERQLAGLQASGEAAFSPDLSGLEARKAEVEATIRGLEAKLQAIKPAST
FT                   DMAPPDFAAAIKAAEKAGADAGEGITDGIRAQIPAAGRAGTEAGQNAGQGVAKGIEQEG
FT                   PKAVDKAKTLWERIKDVFAEGVNIPINFEGGSGAAAITKASYVSLPGGAGADLGRPRSR
FT                   LGSIAHRGGASAGAPGPAVSPQAEFGPGVDAARLPAGMRNNNPGNIKFTRVGAFGTVIG
FT                   PSRNTDQGDPQAVFANAEDGMRALVDLARRKWEGGRQTVADLIARRGGWTPGNHQAAAN
FT                   IARGAGVGLHERIDLSDDAVMQRFVRALITQEHGPAGRLYSDELIRKALRPREAPAAQA
FT                   AAKAPERPAIPGMMPGAERVNPGYGKPLHQGGTGLSRYSDEDLRRMRERQDALDRIKAT
FT                   GEGITPEQAEAARRRIQERYTPRPASPEATPGLTRPAPGVTPSGVPAITPKADPNGLDA
FT                   LGTKADGAKDKLAALSGVSISPQVSTGNLDALIAKANQALAALQRIPGAVASANASIAS
FT                   VSPAGAGGGSTGKVRDALSDNFA"
     MVSKTASLII RLTDDVSGPA GKAAQALKGL STAGDGLSRL KNAASGLDQL GAKMRQAKIE        60
     VERAGKELAA AEKRVAFFRA SRERGSHNYP AFEASGLVAE AEARLKAAKR AHAAAERQMA       120
     ATRAIFVDQK RTVASLTASL SAASGGLKDL RSAETNVAGA AAQTTGALSR QTGVLSSVAG       180
     GARTAARAYR DLAAGMSEAG RKALATVEAN RRLVEGMSAP ARAAAAAAEA HRKAAMQGRA       240
     DRAASRREAL ETIGAGAGLI AAHRGKAIGL QAVQSAASMD YATRYQHVAT DVSEEDQRRL       300
     LIPQAKRIGQ ETKFSNEDIV HAQTATMQGL PFKDPALKAR VGEALVDQAR HYAVIMQSDM       360
     TRASEGIRSF LQNTNKDIST PEKSLAEAQR GTNLIVKMAK LGGMSDEDAQ QFIKFGFPTG       420
     TQAGLSDVTL AALGASGRRA GLRGDELGVF ARAMASKLVA PTSKGLDALT AAGIHYNRYT       480
     TMPGGLNVDN LEAFSKRRFG KGFTEDQRTR LADLLENSEV VGERDEFTKQ VSAIVAEGFG       540
     KGKSGKTKAQ DVQKIAKMVG DFHKLSVESV DTEGLLRAIF SNPKMTAALL NAFFTDKHGG       600
     KAGMIAPKMA QFNQDVEELK KIGEDPLFAE RKSKYMTQGL GGSIDNLKGS FETMVLSIGQ       660
     ANEGLIRFAA DGLAKGTDLF SNLSQTQQQI LSLVGGGAAV AGGVWGTATL MKNLLGFGAS       720
     AQALTGSAGL LSKSALELSA AAATLGGKGV LPEVAKTAAP VAAGAAGVTA GAIAGAVAAG       780
     VGTAALVYAA GGRYQPEEVV RMRDELSELN KRLERQNESV YRQQSQGDDA TAEIARRDAT       840
     LARIKELTAA LEKAATAQGT ETKGEEGPRA GLKLSEAARE ALDARKAGAA VQAPPETVSA       900
     PAPSVRPPEV SGVTDAATKA GGEAPKPAEG ASQAAPAAAP VMAPTVRAPA PPARPPELGQ       960
     APAPLPPARS PEMGLPPDHA AAIQAATSAL ATYRAELAGI ERQLAGLQAS GEAAFSPDLS      1020
     GLEARKAEVE ATIRGLEAKL QAIKPASTDM APPDFAAAIK AAEKAGADAG EGITDGIRAQ      1080
     IPAAGRAGTE AGQNAGQGVA KGIEQEGPKA VDKAKTLWER IKDVFAEGVN IPINFEGGSG      1140
     AAAITKASYV SLPGGAGADL GRPRSRLGSI AHRGGASAGA PGPAVSPQAE FGPGVDAARL      1200
     PAGMRNNNPG NIKFTRVGAF GTVIGPSRNT DQGDPQAVFA NAEDGMRALV DLARRKWEGG      1260
     RQTVADLIAR RGGWTPGNHQ AAANIARGAG VGLHERIDLS DDAVMQRFVR ALITQEHGPA      1320
     GRLYSDELIR KALRPREAPA AQAAAKAPER PAIPGMMPGA ERVNPGYGKP LHQGGTGLSR      1380
     YSDEDLRRMR ERQDALDRIK ATGEGITPEQ AEAARRRIQE RYTPRPASPE ATPGLTRPAP      1440
     GVTPSGVPAI TPKADPNGLD ALGTKADGAK DKLAALSGVS ISPQVSTGNL DALIAKANQA      1500
     LAALQRIPGA VASANASIAS VSPAGAGGGS TGKVRDALSD NFA                        1543
//

If you have problems or comments...

PBIL Back to PBIL home page