(data stored in ACNUC7421 zone)

EMBL: CP001349.PE559

CP001349.PE559       Location/Qualifiers
FT   CDS             640878..641309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55611"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN9"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5180"
FT                   /protein_id="ACL55611.1"
FT                   /translation="MLSGLVLLALAEIGTGAPTVQIVTPRKLIDNPRSYLHQKTLVQNI
FT                   HCIDVPRGRLICIVPIGGQIIRLEGSALGAKTPLSIAERLTGDYKGTANISNAACVVDV
FT                   EIEPTSVVKDMLDTPSGSMPLLTVYSPLIEMYRPRGRER"
     MLSGLVLLAL AEIGTGAPTV QIVTPRKLID NPRSYLHQKT LVQNIHCIDV PRGRLICIVP        60
     IGGQIIRLEG SALGAKTPLS IAERLTGDYK GTANISNAAC VVDVEIEPTS VVKDMLDTPS       120
     GSMPLLTVYS PLIEMYRPRG RER                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page