(data stored in ACNUC7421 zone)

EMBL: CP001349.PE56

CP001349.PE56        Location/Qualifiers
FT   CDS             63612..64289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0057"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: met:M446_0057 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55108"
FT                   /db_xref="GOA:B8IU63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU63"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55108.1"
FT                   /translation="MRILLVEDTQDVGEAIVARLRTLGHAVDWERDGAMGDAVLEVQPY
FT                   DLVILDVNLPGLDGFAILKRMRARRGRTPVLVLTARSEVDDRVGALDLGADDYLVKPFD
FT                   FRELEARVRALLRRHSGHADNAIACGNLSLDRAARSASVGGQPLDLTRREWTLIEILAA
FT                   RPGRIFGKAELLDRLSTFEEEPSENALEQIVARLRRKLAQAGAEPEIRTLRGLGYQVVC
FT                   PEP"
     MRILLVEDTQ DVGEAIVARL RTLGHAVDWE RDGAMGDAVL EVQPYDLVIL DVNLPGLDGF        60
     AILKRMRARR GRTPVLVLTA RSEVDDRVGA LDLGADDYLV KPFDFRELEA RVRALLRRHS       120
     GHADNAIACG NLSLDRAARS ASVGGQPLDL TRREWTLIEI LAARPGRIFG KAELLDRLST       180
     FEEEPSENAL EQIVARLRRK LAQAGAEPEI RTLRGLGYQV VCPEP                       225
//

If you have problems or comments...

PBIL Back to PBIL home page