(data stored in ACNUC7421 zone)

EMBL: CP001349.PE560

CP001349.PE560       Location/Qualifiers
FT   CDS             complement(641317..642204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0575"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: BRO domain protein; KEGG: ecv:APECO1_4056
FT                   putative anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55612"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP0"
FT                   /inference="protein motif:PFAM:PF02498"
FT                   /protein_id="ACL55612.1"
FT                   /translation="MNALQTFDFESQAVRSFERDGQVWFVAADVCRALGLTNSRMALQA
FT                   LDDDEKGVSSIYTPGGRQEMAIISEPGLYTIILRCREATKPGSLPHRFRKWVTGEVLPA
FT                   LRKTGRYSMRAGEGEASTFDYERIGAMARLVSEARHVYGREAARALWERLPLPQVPNPA
FT                   ARMMYEGRENDGPGCLAHLMCRAAGNGQSLRTVIEAAWRDGPKRSWLFERGIKVVLDAR
FT                   DRRGDHIAIADRHPFLQQVFAETCWADDWFLPLLSVEGAKASRRPMEFGHGVEEKSLGR
FT                   VRAVLIPKLQVQLG"
     MNALQTFDFE SQAVRSFERD GQVWFVAADV CRALGLTNSR MALQALDDDE KGVSSIYTPG        60
     GRQEMAIISE PGLYTIILRC REATKPGSLP HRFRKWVTGE VLPALRKTGR YSMRAGEGEA       120
     STFDYERIGA MARLVSEARH VYGREAARAL WERLPLPQVP NPAARMMYEG RENDGPGCLA       180
     HLMCRAAGNG QSLRTVIEAA WRDGPKRSWL FERGIKVVLD ARDRRGDHIA IADRHPFLQQ       240
     VFAETCWADD WFLPLLSVEG AKASRRPMEF GHGVEEKSLG RVRAVLIPKL QVQLG            295
//

If you have problems or comments...

PBIL Back to PBIL home page