(data stored in ACNUC7421 zone)

EMBL: CP001349.PE561

CP001349.PE561       Location/Qualifiers
FT   CDS             complement(642375..642725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55613"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55613.1"
FT                   /translation="MPQASGDDSTRPTAMHPRRRLARRRLIEDTIETLIAYLDEADGDP
FT                   DLEDEGDDEPSLGSPERTAEFGVTVIDGDRYHILSTSQIHWGDGGTMDREVEDEHDEPD
FT                   GDEFDDDGLDER"
     MPQASGDDST RPTAMHPRRR LARRRLIEDT IETLIAYLDE ADGDPDLEDE GDDEPSLGSP        60
     ERTAEFGVTV IDGDRYHILS TSQIHWGDGG TMDREVEDEH DEPDGDEFDD DGLDER           116
//

If you have problems or comments...

PBIL Back to PBIL home page