(data stored in ACNUC7421 zone)

EMBL: CP001349.PE562

CP001349.PE562       Location/Qualifiers
FT   CDS             complement(643257..643793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55614"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP2"
FT                   /inference="similar to AA sequence:KEGG:M446_4128"
FT                   /protein_id="ACL55614.1"
FT                   /translation="MLSFSQLVTNFEPAGKAAPEAPQAAPAPAGAKTPRRRKSPPTAAP
FT                   SAAQAAPAPEAPPPPEPPVFVGGKPRSAAFPLDFPVQFQGRVYDTVVMRRPTAREVAEF
FT                   YDALAETGFKGFPIFYTPEGDRIPFEVIENLDPDDDDRIMERLMDFLPRRMLPHTETPN
FT                   SVSTPASGETTAPTS"
     MLSFSQLVTN FEPAGKAAPE APQAAPAPAG AKTPRRRKSP PTAAPSAAQA APAPEAPPPP        60
     EPPVFVGGKP RSAAFPLDFP VQFQGRVYDT VVMRRPTARE VAEFYDALAE TGFKGFPIFY       120
     TPEGDRIPFE VIENLDPDDD DRIMERLMDF LPRRMLPHTE TPNSVSTPAS GETTAPTS         178
//

If you have problems or comments...

PBIL Back to PBIL home page