(data stored in ACNUC7421 zone)

EMBL: CP001349.PE563

CP001349.PE563       Location/Qualifiers
FT   CDS             complement(643852..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0578"
FT                   /product="major tail tube protein"
FT                   /note="PFAM: major tail tube protein; KEGG: met:M446_4129
FT                   major tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55615"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP3"
FT                   /inference="protein motif:PFAM:PF04985"
FT                   /protein_id="ACL55615.1"
FT                   /translation="MAQDILIIEEVDVRREDDAEDTRVFTINKMGLPALKRKTSEHTPG
FT                   GGIGTVNYALPMIDALEPTFAVKGVDLDVLRKYGFTSGTNDKWIFAASLRNKKTNVLLP
FT                   VRATIQGIICEWSPGEHTPGELLDCDHTMQEVKYYKLVVNNERIFEWDFYGRKWFNGDT
FT                   DVFAEYRATLGA"
     MAQDILIIEE VDVRREDDAE DTRVFTINKM GLPALKRKTS EHTPGGGIGT VNYALPMIDA        60
     LEPTFAVKGV DLDVLRKYGF TSGTNDKWIF AASLRNKKTN VLLPVRATIQ GIICEWSPGE       120
     HTPGELLDCD HTMQEVKYYK LVVNNERIFE WDFYGRKWFN GDTDVFAEYR ATLGA            175
//

If you have problems or comments...

PBIL Back to PBIL home page