(data stored in ACNUC7421 zone)

EMBL: CP001349.PE564

CP001349.PE564       Location/Qualifiers
FT   CDS             complement(644462..645748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55616"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP4"
FT                   /inference="similar to AA sequence:KEGG:M446_4130"
FT                   /protein_id="ACL55616.1"
FT                   /translation="MTAPTFGYINTRPKDDPVVVAGADFSKVGMCSTSEDADATVFPPD
FT                   EPVRFTSTDPAYLSKLGSGYLYDAVVNINAQLEGKGADVTVVRVPEGTSTDPTTKLEQT
FT                   FANIIGTAGAQTGLHALRAATDHVKATSRLVGVPGYLAQQLDGPTVANPIVAALPEHLD
FT                   ALRAVCVVDVAPGTREAAIAARETMSSMRLIPLGVGVRAYKTINSTATLTTMPGSPCVL
FT                   GLFVRQDNNNGGKPFDTIANLPLYGIADLSRPIAFSLTDGSVEGQTLLAADVSIIVRGE
FT                   SANVDSIADGGFVFIGTESAEISAAWTQFHQVRGQDYIDVEYQKITRQYLGRRLYPRLV
FT                   ESWLGSINNMLRNHVNNDPPDILGYNLVFPKGLNSDDELTLGHLHIQSYIQQAPAFTVA
FT                   QNDVRQYRPALAALVAAVQAGTGPMTATV"
     MTAPTFGYIN TRPKDDPVVV AGADFSKVGM CSTSEDADAT VFPPDEPVRF TSTDPAYLSK        60
     LGSGYLYDAV VNINAQLEGK GADVTVVRVP EGTSTDPTTK LEQTFANIIG TAGAQTGLHA       120
     LRAATDHVKA TSRLVGVPGY LAQQLDGPTV ANPIVAALPE HLDALRAVCV VDVAPGTREA       180
     AIAARETMSS MRLIPLGVGV RAYKTINSTA TLTTMPGSPC VLGLFVRQDN NNGGKPFDTI       240
     ANLPLYGIAD LSRPIAFSLT DGSVEGQTLL AADVSIIVRG ESANVDSIAD GGFVFIGTES       300
     AEISAAWTQF HQVRGQDYID VEYQKITRQY LGRRLYPRLV ESWLGSINNM LRNHVNNDPP       360
     DILGYNLVFP KGLNSDDELT LGHLHIQSYI QQAPAFTVAQ NDVRQYRPAL AALVAAVQAG       420
     TGPMTATV                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page