(data stored in ACNUC7421 zone)

EMBL: CP001349.PE565

CP001349.PE565       Location/Qualifiers
FT   CDS             complement(645824..646333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55617"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP5"
FT                   /inference="similar to AA sequence:KEGG:M446_4131"
FT                   /protein_id="ACL55617.1"
FT                   /translation="MTQPVLSGVAIDLTHAGLSYRGHDVPALRRAGVPEPVILAAVKDL
FT                   LQAGIDADAEALRARLASPGAGQAMEYQEAAAQAAAALTAPGSATADAYPMLAATVGID
FT                   IDPETGAPAVDVLGVARAVAAASARWLTAGAAIRKARLTGKAAVAAAATPEAAQAARVE
FT                   IIWPTF"
     MTQPVLSGVA IDLTHAGLSY RGHDVPALRR AGVPEPVILA AVKDLLQAGI DADAEALRAR        60
     LASPGAGQAM EYQEAAAQAA AALTAPGSAT ADAYPMLAAT VGIDIDPETG APAVDVLGVA       120
     RAVAAASARW LTAGAAIRKA RLTGKAAVAA AATPEAAQAA RVEIIWPTF                   169
//

If you have problems or comments...

PBIL Back to PBIL home page