(data stored in ACNUC7421 zone)

EMBL: CP001349.PE566

CP001349.PE566       Location/Qualifiers
FT   CDS             complement(646364..647128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55618"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP6"
FT                   /inference="similar to AA sequence:KEGG:M446_4132"
FT                   /protein_id="ACL55618.1"
FT                   /translation="MTTVVEGLENATTALEQAVADVLGLKSQLLAPYNQNVTQTTNIVN
FT                   QFINRSAYEVVWIDEIDGSDTNDGKTADTPKRSLDAAIAAMGMSATEFRLLSDVTLKQK
FT                   TNLYANVIFSGVQKSAAAPGYIPFNRRMSFLGTAENSPQPGVGTFCAGLFVYTANVQFG
FT                   FIDFALPDVPAGIGYPYAFSAQAQASFVVYNTTLTVGSPAAGSLFGSILGRVTASLSLV
FT                   LGTGAAGHVFDGVAAGGNPNLAWKYDTNITSA"
     MTTVVEGLEN ATTALEQAVA DVLGLKSQLL APYNQNVTQT TNIVNQFINR SAYEVVWIDE        60
     IDGSDTNDGK TADTPKRSLD AAIAAMGMSA TEFRLLSDVT LKQKTNLYAN VIFSGVQKSA       120
     AAPGYIPFNR RMSFLGTAEN SPQPGVGTFC AGLFVYTANV QFGFIDFALP DVPAGIGYPY       180
     AFSAQAQASF VVYNTTLTVG SPAAGSLFGS ILGRVTASLS LVLGTGAAGH VFDGVAAGGN       240
     PNLAWKYDTN ITSA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page