(data stored in ACNUC7421 zone)

EMBL: CP001349.PE567

CP001349.PE567       Location/Qualifiers
FT   CDS             complement(647141..647710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0582"
FT                   /product="pyocin R2_PP, tail fiber protein, putative"
FT                   /note="KEGG: met:M446_4133 pyocin R2_PP, tail fiber
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55619"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP7"
FT                   /inference="similar to AA sequence:KEGG:M446_4133"
FT                   /protein_id="ACL55619.1"
FT                   /translation="MSDPLVITLTRPGLAACVRAQGDGLQAVVDRVAVGRGLNTAGTYG
FT                   GYTPSKDATSLQNEVIRVPLISGSKLGAPGEARFRVLAEVPKTSSPAEYAIREVGFFLT
FT                   DGTLLALWSDPTPGFVLASKTALSDVALSLDLVLDQIPTGSLTLTVLDPEIPEWAATIA
FT                   ELLATAARTFSADLAQEQRMCAHGIY"
     MSDPLVITLT RPGLAACVRA QGDGLQAVVD RVAVGRGLNT AGTYGGYTPS KDATSLQNEV        60
     IRVPLISGSK LGAPGEARFR VLAEVPKTSS PAEYAIREVG FFLTDGTLLA LWSDPTPGFV       120
     LASKTALSDV ALSLDLVLDQ IPTGSLTLTV LDPEIPEWAA TIAELLATAA RTFSADLAQE       180
     QRMCAHGIY                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page