(data stored in ACNUC7421 zone)

EMBL: CP001349.PE568

CP001349.PE568       Location/Qualifiers
FT   CDS             complement(647703..648389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0583"
FT                   /product="phage tail protein I"
FT                   /note="TIGRFAM: phage tail protein I; PFAM: tail protein I;
FT                   KEGG: met:M446_4134 phage tail protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55620"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP8"
FT                   /inference="protein motif:TFAM:TIGR01634"
FT                   /protein_id="ACL55620.1"
FT                   /translation="MADPVKRVNLLPQGATAREKAHADTDGRLDDRLAEARAITARKDP
FT                   TTCPVDLLPYLAWERSVDVWDPAWPEAVKRAVITAAPTVHAYKGTAYAVKTALAALQVQ
FT                   ADVTEWWQANPQGQPYTFSQPYTFSVVAHARSPIYGHVLLDARLIKVVFATVMRTKPLS
FT                   RAFDLTVAANMPGALGAAGIGVARSTVRVPVYADNSEAFASTLGAAGVAVARSMVRVAM
FT                   VSPPDV"
     MADPVKRVNL LPQGATAREK AHADTDGRLD DRLAEARAIT ARKDPTTCPV DLLPYLAWER        60
     SVDVWDPAWP EAVKRAVITA APTVHAYKGT AYAVKTALAA LQVQADVTEW WQANPQGQPY       120
     TFSQPYTFSV VAHARSPIYG HVLLDARLIK VVFATVMRTK PLSRAFDLTV AANMPGALGA       180
     AGIGVARSTV RVPVYADNSE AFASTLGAAG VAVARSMVRV AMVSPPDV                    228
//

If you have problems or comments...

PBIL Back to PBIL home page