(data stored in ACNUC7421 zone)

EMBL: CP001349.PE569

CP001349.PE569       Location/Qualifiers
FT   CDS             complement(648382..648564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0584"
FT                   /product="baseplate J family protein"
FT                   /note="KEGG: met:M446_4135 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55621"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP9"
FT                   /inference="similar to AA sequence:KEGG:M446_4135"
FT                   /protein_id="ACL55621.1"
FT                   /translation="MLAGAACVPGSDGAIVVSDFDLISPASDVNGGVISPDNPGPAYCA
FT                   PYCTEIVVTVEVGDG"
     MLAGAACVPG SDGAIVVSDF DLISPASDVN GGVISPDNPG PAYCAPYCTE IVVTVEVGDG        60
//

If you have problems or comments...

PBIL Back to PBIL home page