(data stored in ACNUC7421 zone)

EMBL: CP001349.PE57

CP001349.PE57        Location/Qualifiers
FT   CDS             64286..65671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0058"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: met:M446_0058 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55109"
FT                   /db_xref="GOA:B8IU64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU64"
FT                   /inference="protein motif:PFAM:PF08521"
FT                   /protein_id="ACL55109.1"
FT                   /translation="MIGRTPSLFLRLVTVLGLVLAVGAALLLGAAWTSARLAADQAYDR
FT                   LLVGAALQIAETIASDGREITVDPPFSAFETLGLAPRDRIFYKVVDPSDGLLTGSPDLA
FT                   VPVDRARLGDGPLLLDATHRGEPVRVVVAGRYVPDIPKAGWAAVVVAQTREARNGLAGD
FT                   LTAKASLLVLTMSALALGAVTVAVRAALRPLAALERVLAGRGPNDLDPLDLAVPREIHL
FT                   LVTSINHFMDRLSGHMAIMRRFIADAAHQIRTPLAALGAQVDLLSAEGDEARRREQVIR
FT                   VQERTAELGRLTNQLLNHAMVIHRARSIPLAPVDLGAIARRTLIDAIPLAGTRPIDFGY
FT                   EGPDEPLPIRGDPIALREALANLIHNGIKHGAPGRLTVRTRRERDRITVEVVDDGAGIP
FT                   AAEWRRVREPFQAASGGAIGSGLGLAIAAEVTAAHGGEMRFESRSDEGFAVLLSFPAAE
FT                   AAP"
     MIGRTPSLFL RLVTVLGLVL AVGAALLLGA AWTSARLAAD QAYDRLLVGA ALQIAETIAS        60
     DGREITVDPP FSAFETLGLA PRDRIFYKVV DPSDGLLTGS PDLAVPVDRA RLGDGPLLLD       120
     ATHRGEPVRV VVAGRYVPDI PKAGWAAVVV AQTREARNGL AGDLTAKASL LVLTMSALAL       180
     GAVTVAVRAA LRPLAALERV LAGRGPNDLD PLDLAVPREI HLLVTSINHF MDRLSGHMAI       240
     MRRFIADAAH QIRTPLAALG AQVDLLSAEG DEARRREQVI RVQERTAELG RLTNQLLNHA       300
     MVIHRARSIP LAPVDLGAIA RRTLIDAIPL AGTRPIDFGY EGPDEPLPIR GDPIALREAL       360
     ANLIHNGIKH GAPGRLTVRT RRERDRITVE VVDDGAGIPA AEWRRVREPF QAASGGAIGS       420
     GLGLAIAAEV TAAHGGEMRF ESRSDEGFAV LLSFPAAEAA P                           461
//

If you have problems or comments...

PBIL Back to PBIL home page