(data stored in ACNUC7421 zone)

EMBL: CP001349.PE570

CP001349.PE570       Location/Qualifiers
FT   CDS             complement(648611..649132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0585"
FT                   /product="putative transposase of insertion sequence"
FT                   /note="KEGG: mrd:Mrad2831_5181 putative transposase of
FT                   insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55622"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAL5"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5181"
FT                   /protein_id="ACL55622.1"
FT                   /translation="MFLDETAATTSMVRRYGWAPRGERCRLAAPAGHWKTTTVIAGLRT
FT                   SGPDAIALLDGPVTGERFRAYVTDTLVPTLRPGDTVILDNLGAHKVAGVREAIAATGAR
FT                   LLYLPPYSPEFNPIEQAFAKLKALLRRAAARSVSELWAAIHQAFKCFSPAECRNYFTAA
FT                   GYEDDAYAST"
     MFLDETAATT SMVRRYGWAP RGERCRLAAP AGHWKTTTVI AGLRTSGPDA IALLDGPVTG        60
     ERFRAYVTDT LVPTLRPGDT VILDNLGAHK VAGVREAIAA TGARLLYLPP YSPEFNPIEQ       120
     AFAKLKALLR RAAARSVSEL WAAIHQAFKC FSPAECRNYF TAAGYEDDAY AST              173
//

If you have problems or comments...

PBIL Back to PBIL home page