(data stored in ACNUC7421 zone)

EMBL: CP001349.PE571

CP001349.PE571       Location/Qualifiers
FT   CDS             complement(649189..649572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0586"
FT                   /product="transposase"
FT                   /note="KEGG: mrd:Mrad2831_5182 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55623"
FT                   /db_xref="GOA:B8IC28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC28"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5182"
FT                   /protein_id="ACL55623.1"
FT                   /translation="MPSALSVDLRQRVVSAVAEGASCHQAAARFGVSVASVSRWSRQQE
FT                   GQGDVTPKPMGGDQRSQRIEAHAELILQTYQAHPQSFLHELCETLQEQGVPVSRSSLSR
FT                   FFARHRITRKKGRRTQLSRSGRM"
     MPSALSVDLR QRVVSAVAEG ASCHQAAARF GVSVASVSRW SRQQEGQGDV TPKPMGGDQR        60
     SQRIEAHAEL ILQTYQAHPQ SFLHELCETL QEQGVPVSRS SLSRFFARHR ITRKKGRRTQ       120
     LSRSGRM                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page