(data stored in ACNUC7421 zone)

EMBL: CP001349.PE572

CP001349.PE572       Location/Qualifiers
FT   CDS             complement(649655..650446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0587"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG:
FT                   met:M446_4135 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55624"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ2"
FT                   /inference="protein motif:PFAM:PF04865"
FT                   /protein_id="ACL55624.1"
FT                   /translation="MVPSKRFADIDLSRLPPLPAVPGFDTIYAARMADVAARLNKAGIP
FT                   YNVTNLKADTVAIIQGAGAYREELVYTAHDDASRAVLLATSWGPYLDHLGATQTPPVAR
FT                   LPLVDRPRPYVFGTDSVSDWEEDDDFRARIQLAPEELSGAGPEGAYLSFALGVAGIRAA
FT                   SCYGPMSFGGTPDNPFTPLGHVHVPIVGTDGDGTASDALVAAVQAALRPDDRRPIADFV
FT                   TASAATIIPYRIEAVLYVGGGADRAIVKAAAEKRFAAQARL"
     MVPSKRFADI DLSRLPPLPA VPGFDTIYAA RMADVAARLN KAGIPYNVTN LKADTVAIIQ        60
     GAGAYREELV YTAHDDASRA VLLATSWGPY LDHLGATQTP PVARLPLVDR PRPYVFGTDS       120
     VSDWEEDDDF RARIQLAPEE LSGAGPEGAY LSFALGVAGI RAASCYGPMS FGGTPDNPFT       180
     PLGHVHVPIV GTDGDGTASD ALVAAVQAAL RPDDRRPIAD FVTASAATII PYRIEAVLYV       240
     GGGADRAIVK AAAEKRFAAQ ARL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page