(data stored in ACNUC7421 zone)

EMBL: CP001349.PE573

CP001349.PE573       Location/Qualifiers
FT   CDS             complement(650477..650899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0588"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein; KEGG: met:M446_4136
FT                   gpW/GP25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55625"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ3"
FT                   /inference="protein motif:PFAM:PF04965"
FT                   /protein_id="ACL55625.1"
FT                   /translation="MASCGLDRDTGEPLFDLAHVAQAVQTIFTTRLGERVMLRWFGGGL
FT                   AELLGRRITPALLRSYRMLLALAIATWEPRLQVVKIDGTGNSTDAIALGHLKFTAICYY
FT                   RPRGHLGDYTVEGGPRALNIFSPDGKTLRVQLARVA"
     MASCGLDRDT GEPLFDLAHV AQAVQTIFTT RLGERVMLRW FGGGLAELLG RRITPALLRS        60
     YRMLLALAIA TWEPRLQVVK IDGTGNSTDA IALGHLKFTA ICYYRPRGHL GDYTVEGGPR       120
     ALNIFSPDGK TLRVQLARVA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page