(data stored in ACNUC7421 zone)

EMBL: CP001349.PE575

CP001349.PE575       Location/Qualifiers
FT   CDS             complement(651285..651854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0590"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; KEGG:
FT                   met:M446_4138 phage baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55627"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ5"
FT                   /inference="protein motif:TFAM:TIGR01644"
FT                   /protein_id="ACL55627.1"
FT                   /translation="MSDFSDLLDAVLELRREHEALKTRVANLIRPGKVTDRDHEKGVRI
FT                   DLGGGTDEEPNKSTWVKSSDHSGVMSYLPREGEQGWLLSPNGDQEQGAFWPLTHSDQKR
FT                   DPAPDADTTVLFNRDDVTISIKDGTVHIKTKKKITWEVDGKSYTFDGKEHVFQGDKIKH
FT                   DGKNIGKDHVHGGVQTGNLKTDVPDA"
     MSDFSDLLDA VLELRREHEA LKTRVANLIR PGKVTDRDHE KGVRIDLGGG TDEEPNKSTW        60
     VKSSDHSGVM SYLPREGEQG WLLSPNGDQE QGAFWPLTHS DQKRDPAPDA DTTVLFNRDD       120
     VTISIKDGTV HIKTKKKITW EVDGKSYTFD GKEHVFQGDK IKHDGKNIGK DHVHGGVQTG       180
     NLKTDVPDA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page