(data stored in ACNUC7421 zone)

EMBL: CP001349.PE576

CP001349.PE576       Location/Qualifiers
FT   CDS             complement(651851..652627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55628"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ6"
FT                   /inference="similar to AA sequence:KEGG:M446_4139"
FT                   /protein_id="ACL55628.1"
FT                   /translation="MSLTGFAIRTCLKRALRGATLAEDRVKDSLITPLDLLAADTPQPL
FT                   LIVSTDDDLRQAEVRTPRDRRRELDVVIEMALATAVAIDDGTVRLEMPHTDAGMEATLD
FT                   IMAWQVRAALKDPTNPWAELYRTFRGEVRKILTRRGASTEDGVRFAARQIIITVDPLQE
FT                   PERGRDAIPTPWDGLVAQMRADAELEPYGDLLATLLTGSTLPPWQAVQAQLGQTRAVMD
FT                   AVGLSALHGAEAEPPVSQVTITTDRGDIVETLEPVP"
     MSLTGFAIRT CLKRALRGAT LAEDRVKDSL ITPLDLLAAD TPQPLLIVST DDDLRQAEVR        60
     TPRDRRRELD VVIEMALATA VAIDDGTVRL EMPHTDAGME ATLDIMAWQV RAALKDPTNP       120
     WAELYRTFRG EVRKILTRRG ASTEDGVRFA ARQIIITVDP LQEPERGRDA IPTPWDGLVA       180
     QMRADAELEP YGDLLATLLT GSTLPPWQAV QAQLGQTRAV MDAVGLSALH GAEAEPPVSQ       240
     VTITTDRGDI VETLEPVP                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page