(data stored in ACNUC7421 zone)

EMBL: CP001349.PE577

CP001349.PE577       Location/Qualifiers
FT   CDS             complement(652627..653037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55629"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ7"
FT                   /inference="similar to AA sequence:KEGG:Oant_1502"
FT                   /protein_id="ACL55629.1"
FT                   /translation="MPSPFALAMQKAHTVRTATFGEAIRITPMAGEGEMAARTPDPARP
FT                   EREVRGVFTLRPGEDTLQGVRRGTELNGMTRVAVAPAQVWFEASVLAGLGYALKPDDRI
FT                   TLTERPGQPVYTIVKRGPTDLDDATVPLVRAT"
     MPSPFALAMQ KAHTVRTATF GEAIRITPMA GEGEMAARTP DPARPEREVR GVFTLRPGED        60
     TLQGVRRGTE LNGMTRVAVA PAQVWFEASV LAGLGYALKP DDRITLTERP GQPVYTIVKR       120
     GPTDLDDATV PLVRAT                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page