(data stored in ACNUC7421 zone)

EMBL: CP001349.PE578

CP001349.PE578       Location/Qualifiers
FT   CDS             complement(653424..654461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55630"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ8"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_1263"
FT                   /protein_id="ACL55630.1"
FT                   /translation="MPTILDVFQSPHFSARALTDGVNAVPNRYHRLEQLNVFPIRPVPT
FT                   TYVTIEYRNGILNLLPTRERGTAGSQGLRGRRDKRTFEIPHIPHDDALMATDLQNRITF
FT                   GTNDVLTPMMDAMTEKLADMTAKHFITLEHLRVGAIKGQILDADGSLIYDLFQEFGITA
FT                   KVFAFTFSDPNFDVGAKARELKGYLEDNLQGEVMTSVRALCSQEFFASFVGHPSVQKAY
FT                   QFYTSAQEPLRNDVRKGFEFKGISWEEYRGSATYLEADNSQTRTRFIDQGTAQFYPEGT
FT                   QQTFATYIAPPDSVDEANMAPKPGQLIYAKQERMKFDKGIEIHTESNPLPLCKRPALLV
FT                   KGTSN"
     MPTILDVFQS PHFSARALTD GVNAVPNRYH RLEQLNVFPI RPVPTTYVTI EYRNGILNLL        60
     PTRERGTAGS QGLRGRRDKR TFEIPHIPHD DALMATDLQN RITFGTNDVL TPMMDAMTEK       120
     LADMTAKHFI TLEHLRVGAI KGQILDADGS LIYDLFQEFG ITAKVFAFTF SDPNFDVGAK       180
     ARELKGYLED NLQGEVMTSV RALCSQEFFA SFVGHPSVQK AYQFYTSAQE PLRNDVRKGF       240
     EFKGISWEEY RGSATYLEAD NSQTRTRFID QGTAQFYPEG TQQTFATYIA PPDSVDEANM       300
     APKPGQLIYA KQERMKFDKG IEIHTESNPL PLCKRPALLV KGTSN                       345
//

If you have problems or comments...

PBIL Back to PBIL home page