(data stored in ACNUC7421 zone)

EMBL: CP001349.PE579

CP001349.PE579       Location/Qualifiers
FT   CDS             complement(654468..654857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55631"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ9"
FT                   /inference="similar to AA sequence:KEGG:mma_2770"
FT                   /protein_id="ACL55631.1"
FT                   /translation="MPPASYLAREPKRLSDVLRYHQPTYSLDQGTLAANAAALEFATPL
FT                   ALAADGSGQFVPWVPGANDSTGVVVGLSASQTQVKAATQPIAVIARHATVVRNAIEFPA
FT                   GATAAQISAALAALASHGIIARQGA"
     MPPASYLARE PKRLSDVLRY HQPTYSLDQG TLAANAAALE FATPLALAAD GSGQFVPWVP        60
     GANDSTGVVV GLSASQTQVK AATQPIAVIA RHATVVRNAI EFPAGATAAQ ISAALAALAS       120
     HGIIARQGA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page