(data stored in ACNUC7421 zone)

EMBL: CP001349.PE58

CP001349.PE58        Location/Qualifiers
FT   CDS             65668..66780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0059"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: met:M446_0059 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55110"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU65"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55110.1"
FT                   /translation="MIRTVLAALVLILGAGRAGAEEVTRFPAPEWQRVELTIRSAADVD
FT                   AMAPLIRDFQSLSPDVAVIYVEYETADLYAQAAAACAAGRAAGFSADLLISSSVDHLVE
FT                   LANDGCARSYRSAETARLPAYALWRDEVFGFTTEPAVIAYRPDLVPPDDVPHSRAALVD
FT                   LLREKAGRYAGRVGSYDITVSGIGYLFAAYDARSAVTYGRLVEAFGRANLQVRCCTGAL
FT                   IADLEAGRIALGYNLLGSYVYGAMRRGAKLGIVVPRDYTLVLSRAALIPTTAAHAAEGF
FT                   AFLDYLLSERGRRVSRDQAFFFDLTGPLPPGIDGPPSLAAAGVFRPIPLGPALLAVQDH
FT                   AKRARFLAEWRQSIGLDRPAAGPNGQARRP"
     MIRTVLAALV LILGAGRAGA EEVTRFPAPE WQRVELTIRS AADVDAMAPL IRDFQSLSPD        60
     VAVIYVEYET ADLYAQAAAA CAAGRAAGFS ADLLISSSVD HLVELANDGC ARSYRSAETA       120
     RLPAYALWRD EVFGFTTEPA VIAYRPDLVP PDDVPHSRAA LVDLLREKAG RYAGRVGSYD       180
     ITVSGIGYLF AAYDARSAVT YGRLVEAFGR ANLQVRCCTG ALIADLEAGR IALGYNLLGS       240
     YVYGAMRRGA KLGIVVPRDY TLVLSRAALI PTTAAHAAEG FAFLDYLLSE RGRRVSRDQA       300
     FFFDLTGPLP PGIDGPPSLA AAGVFRPIPL GPALLAVQDH AKRARFLAEW RQSIGLDRPA       360
     AGPNGQARRP                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page