(data stored in ACNUC7421 zone)

EMBL: CP001349.PE580

CP001349.PE580       Location/Qualifiers
FT   CDS             complement(654887..656149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0595"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rsq:Rsph17025_0104
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55632"
FT                   /db_xref="GOA:B8IDR0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR0"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACL55632.1"
FT                   /translation="MSNPLLARFAGEPALVAPHARDRFEACLAAVMAAEHGPEMVREGA
FT                   AAEDGFWPEPGSWRAAYRPYVVTGGVLQIPVKGVLLHDFSFAVGSLVTGYVYIRRAFER
FT                   GMADPEVRGIALICDSPGGEVAGNFDLVDVLYAARGAKPVRAFAHEGAYSAAYSIASAA
FT                   DRIIVSRTGGVGSIGVVTAHIDASGALAQAGLKVTFIFAGEHKVDGNSAEPLPPEVKDR
FT                   IQARIDGLYDIFVAAVARNRSLKETAVRATKALTYAADEAIRTGLADAVGALDDAVAAF
FT                   AAELTPTAEDPSMITPEAHEAAVAAARADGEAAGRTAGEAVGATAAKVRIKAILGSDEA
FT                   KGRQDLAEHLAFDTDMAAEAAVAVLAKAPKMAPAAAEGADFLAAMRAQPNPDLGTGRSH
FT                   GADQGPSLADRMRARFDLPAA"
     MSNPLLARFA GEPALVAPHA RDRFEACLAA VMAAEHGPEM VREGAAAEDG FWPEPGSWRA        60
     AYRPYVVTGG VLQIPVKGVL LHDFSFAVGS LVTGYVYIRR AFERGMADPE VRGIALICDS       120
     PGGEVAGNFD LVDVLYAARG AKPVRAFAHE GAYSAAYSIA SAADRIIVSR TGGVGSIGVV       180
     TAHIDASGAL AQAGLKVTFI FAGEHKVDGN SAEPLPPEVK DRIQARIDGL YDIFVAAVAR       240
     NRSLKETAVR ATKALTYAAD EAIRTGLADA VGALDDAVAA FAAELTPTAE DPSMITPEAH       300
     EAAVAAARAD GEAAGRTAGE AVGATAAKVR IKAILGSDEA KGRQDLAEHL AFDTDMAAEA       360
     AVAVLAKAPK MAPAAAEGAD FLAAMRAQPN PDLGTGRSHG ADQGPSLADR MRARFDLPAA       420
//

If you have problems or comments...

PBIL Back to PBIL home page