(data stored in ACNUC7421 zone)

EMBL: CP001349.PE581

CP001349.PE581       Location/Qualifiers
FT   CDS             complement(656179..657777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0596"
FT                   /product="phage portal protein, lambda family"
FT                   /note="TIGRFAM: phage portal protein, lambda family; PFAM:
FT                   portal protein lambda; KEGG: smd:Smed_1658 phage portal
FT                   protein, lambda family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55633"
FT                   /db_xref="GOA:B8IDR1"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR1"
FT                   /inference="protein motif:TFAM:TIGR01539"
FT                   /protein_id="ACL55633.1"
FT                   /translation="MPGLPQILGPDGTPAQRVVASDTAYEGASRRHTDLARFAPFNFSA
FT                   QSAISYDRDLLSARIHDMARNDGWASGGVSRLVDAIIGSGWRLSSTPNARTLGLESDEA
FT                   ATLGETFEAYWQDYATDPDCWCDAGRRFTVGGLLALAFRHFVWDGEALGTLLWLERGGP
FT                   TATALRLIDPDRLSSPPSRMDSETLQDGVELGAYGEPIAYHIRTRHPGDLKATTSVLAW
FT                   ERIERETPWGRRKVLHHFEPERADQYRGVSKFAQIVKKLRMLGRYDEAEVQAAVLNALL
FT                   AAFVESPFDHQALADAMNGGGDDLDKYNAARLNYWDAAPVQLPGVKLNFLFPGEKVTFS
FT                   QAQRPNPGFEMFERVALRNIATALGTTYEQLSSDWSQVNYSSARAALIEVWRGFTARQG
FT                   FFGSGFLFPWYAAVLEEGIETGRLRLPSKLKSKPFRHFKAAYCAGRWIGPGRGWVDPLK
FT                   EAQAASLRIANSFSTLERECADQGTDWQEVLQQRARERKYAAELGLPDVHAPEVKAADS
FT                   GEGDQRPRKTADARD"
     MPGLPQILGP DGTPAQRVVA SDTAYEGASR RHTDLARFAP FNFSAQSAIS YDRDLLSARI        60
     HDMARNDGWA SGGVSRLVDA IIGSGWRLSS TPNARTLGLE SDEAATLGET FEAYWQDYAT       120
     DPDCWCDAGR RFTVGGLLAL AFRHFVWDGE ALGTLLWLER GGPTATALRL IDPDRLSSPP       180
     SRMDSETLQD GVELGAYGEP IAYHIRTRHP GDLKATTSVL AWERIERETP WGRRKVLHHF       240
     EPERADQYRG VSKFAQIVKK LRMLGRYDEA EVQAAVLNAL LAAFVESPFD HQALADAMNG       300
     GGDDLDKYNA ARLNYWDAAP VQLPGVKLNF LFPGEKVTFS QAQRPNPGFE MFERVALRNI       360
     ATALGTTYEQ LSSDWSQVNY SSARAALIEV WRGFTARQGF FGSGFLFPWY AAVLEEGIET       420
     GRLRLPSKLK SKPFRHFKAA YCAGRWIGPG RGWVDPLKEA QAASLRIANS FSTLERECAD       480
     QGTDWQEVLQ QRARERKYAA ELGLPDVHAP EVKAADSGEG DQRPRKTADA RD               532
//

If you have problems or comments...

PBIL Back to PBIL home page