(data stored in ACNUC7421 zone)

EMBL: CP001349.PE59

CP001349.PE59        Location/Qualifiers
FT   CDS             67135..67992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55111"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU66"
FT                   /inference="similar to AA sequence:KEGG:M446_2473"
FT                   /protein_id="ACL55111.1"
FT                   /translation="MSRPSPEHRPPPDADERRAVRPVVCYPVDALAPPDLDSYRAARLG
FT                   WERVAAVTVPPRDARSFTVPAGCFFRIVSVEGPQVGDLNLWSADDLGERFFSGKTRALH
FT                   GTHVTTGHRLWSSLPFLRPLATITDDTLDWYGFDEDGGGVHDVIGTRCDPYTHRLLTGG
FT                   TYHHCCHSNLTRALAAQTGLPPAQAKRHVHDVLNVFMCTGFTRDTHQYFMKASPVRPGD
FT                   YLEFFAEVDLLGALSACPGGDCSAEHSSDVARCYPLLIEVYRPKAPPAGWVSPARNSYA
FT                   APDA"
     MSRPSPEHRP PPDADERRAV RPVVCYPVDA LAPPDLDSYR AARLGWERVA AVTVPPRDAR        60
     SFTVPAGCFF RIVSVEGPQV GDLNLWSADD LGERFFSGKT RALHGTHVTT GHRLWSSLPF       120
     LRPLATITDD TLDWYGFDED GGGVHDVIGT RCDPYTHRLL TGGTYHHCCH SNLTRALAAQ       180
     TGLPPAQAKR HVHDVLNVFM CTGFTRDTHQ YFMKASPVRP GDYLEFFAEV DLLGALSACP       240
     GGDCSAEHSS DVARCYPLLI EVYRPKAPPA GWVSPARNSY AAPDA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page