(data stored in ACNUC7421 zone)

EMBL: CP001349.PE6

CP001349.PE6         Location/Qualifiers
FT   CDS             8901..10046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0007"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: rpb:RPB_4238 PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55058"
FT                   /db_xref="GOA:B8ISZ6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ6"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ACL55058.1"
FT                   /translation="MARLHPLLFQIHWFLGLSAGLVLMLCGVTGALLTFEDEIVEALSP
FT                   GIVTVAPRSAPRLTPDALLARLQAEAPGQRVALLTLSGEPERAARIRFAPEGGRGRGET
FT                   VYVDPYDGRILGPGRGEAAFGTILRLHRWLLIPGDGNGFGRTLTGASLLALVYLALSGL
FT                   YLRWPKRVGDWRVWLRPALSRRGRPLYWSLHAVVGTWVLAIYLVIALTGLWWSFGWYRD
FT                   GAALLLTGRLPRGEAAEARRDGPGSGGSLDRAFAAFETATDGRYAVATLAPPRGPEPIR
FT                   IRSVAPDAPHRQARDEWRIRPDGTVVSSDLYAARPLGEKLAGSMLALHEGRFFGWPGTL
FT                   LFFLAALAMPLFGVTGLLLYLGRRRSRRRAAARAEPVPQRG"
     MARLHPLLFQ IHWFLGLSAG LVLMLCGVTG ALLTFEDEIV EALSPGIVTV APRSAPRLTP        60
     DALLARLQAE APGQRVALLT LSGEPERAAR IRFAPEGGRG RGETVYVDPY DGRILGPGRG       120
     EAAFGTILRL HRWLLIPGDG NGFGRTLTGA SLLALVYLAL SGLYLRWPKR VGDWRVWLRP       180
     ALSRRGRPLY WSLHAVVGTW VLAIYLVIAL TGLWWSFGWY RDGAALLLTG RLPRGEAAEA       240
     RRDGPGSGGS LDRAFAAFET ATDGRYAVAT LAPPRGPEPI RIRSVAPDAP HRQARDEWRI       300
     RPDGTVVSSD LYAARPLGEK LAGSMLALHE GRFFGWPGTL LFFLAALAMP LFGVTGLLLY       360
     LGRRRSRRRA AARAEPVPQR G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page