(data stored in ACNUC7421 zone)

EMBL: CP001349.PE61

CP001349.PE61        Location/Qualifiers
FT   CDS             complement(68448..69587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0063"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   met:M446_3465 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55113"
FT                   /db_xref="GOA:B8IU68"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU68"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACL55113.1"
FT                   /translation="MGLITYLTRIQFERGAIRLIDEELALLGARRPLIVTDRGVVAAGL
FT                   IARIAAASRLVADAPVFDATPENPTEAAVLAARDLFREHGCDAVVAVGGGSPLDLAKGA
FT                   ALLATHAEPLAQYAAILGGLPRIRADQPPVLAVPTTAGTGSEVGRAALITLSDGRKLGF
FT                   ISPHLIPNVAICDPELTIGLPPGLTAATGMDAVTHCIETYLSPRYNPPAEAIALDGLRR
FT                   ATRALRRAVRDGGDLEAREDMMMAALEGGMTFQKGLGAVHSMSHALGGRQAKPLHHGTL
FT                   NAVILPHVLRFNEPACTDKYAALREAMNLPPGADLPAAIEALNRDLGLPATLAELGVTA
FT                   QDCEGLIPWAVEDHSTATNGRPLGADDFRHLFIAALGSS"
     MGLITYLTRI QFERGAIRLI DEELALLGAR RPLIVTDRGV VAAGLIARIA AASRLVADAP        60
     VFDATPENPT EAAVLAARDL FREHGCDAVV AVGGGSPLDL AKGAALLATH AEPLAQYAAI       120
     LGGLPRIRAD QPPVLAVPTT AGTGSEVGRA ALITLSDGRK LGFISPHLIP NVAICDPELT       180
     IGLPPGLTAA TGMDAVTHCI ETYLSPRYNP PAEAIALDGL RRATRALRRA VRDGGDLEAR       240
     EDMMMAALEG GMTFQKGLGA VHSMSHALGG RQAKPLHHGT LNAVILPHVL RFNEPACTDK       300
     YAALREAMNL PPGADLPAAI EALNRDLGLP ATLAELGVTA QDCEGLIPWA VEDHSTATNG       360
     RPLGADDFRH LFIAALGSS                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page