(data stored in ACNUC7421 zone)

EMBL: CP001349.PE62

CP001349.PE62        Location/Qualifiers
FT   CDS             69889..71154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0064"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_4762 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55114"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU69"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55114.1"
FT                   /translation="MRKLAPAATRRLVRVLLASTILVGSHAVTSSVQAADPIRIAVIAE
FT                   AQALAGASIPQAAQLAADEINAKGGIDGRMVELVTYDNKSSAADSVRAFQRAASEDKVH
FT                   AVIASYISEVVLALQPWSARLKMPFITPGAASNEIPLNVHKDYARNKYSFHGYLTSKAQ
FT                   SQAVCDAAKAILVEGRQMKTAVIMSEDAAWTKPLDEGYKECLPKVGLQVLDHIRFSPST
FT                   TDFSPIFSRIEGAKPDVIVTGISHVGVQPTVQWRSQQLPIPMIGIASQATNATFWKETN
FT                   GATEGVLFEMFAAPGTNVTPKTAPFAEAFKAKYGNYPSYAGYTAYDEVYYIADAVRRAG
FT                   STDPDKLVEALEKTDWEGTLGRIQFYGRDDDFTHSIKYGPGLVSGMMMQWQDGKQLAVW
FT                   PPNVANGKLTFPSFVKAGTPAN"
     MRKLAPAATR RLVRVLLAST ILVGSHAVTS SVQAADPIRI AVIAEAQALA GASIPQAAQL        60
     AADEINAKGG IDGRMVELVT YDNKSSAADS VRAFQRAASE DKVHAVIASY ISEVVLALQP       120
     WSARLKMPFI TPGAASNEIP LNVHKDYARN KYSFHGYLTS KAQSQAVCDA AKAILVEGRQ       180
     MKTAVIMSED AAWTKPLDEG YKECLPKVGL QVLDHIRFSP STTDFSPIFS RIEGAKPDVI       240
     VTGISHVGVQ PTVQWRSQQL PIPMIGIASQ ATNATFWKET NGATEGVLFE MFAAPGTNVT       300
     PKTAPFAEAF KAKYGNYPSY AGYTAYDEVY YIADAVRRAG STDPDKLVEA LEKTDWEGTL       360
     GRIQFYGRDD DFTHSIKYGP GLVSGMMMQW QDGKQLAVWP PNVANGKLTF PSFVKAGTPA       420
     N                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page