(data stored in ACNUC7421 zone)

EMBL: CP001349.PE63

CP001349.PE63        Location/Qualifiers
FT   CDS             71240..72115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0065"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4763 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55115"
FT                   /db_xref="GOA:B8IU70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU70"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55115.1"
FT                   /translation="MTAIQILIDGFAISALYALGATGFTLIFGVSGVLNLSHGALMVTA
FT                   AVVAWAASSELGLGSYAGAAVGVAVCTLLTLATYGIVVKPIDRSKAIPAEEKEIFILTG
FT                   TLLWGIMIQEFIAYLFTSNAKTVMPIVEGVVTIAGVRTPWNQIFTAVVCWGTIALLWLL
FT                   VNRTRTGKVVLAASMNPRGVTLLGFELSKIYVAIWLIYGVLAGIAGVLLGQFLGVSSYS
FT                   VGPLTASAFSIVVLGGLGSVSGSLIAAYVVGYLETITAYLISPAYRTIPALLLLVAVMY
FT                   VRPQGLLGRR"
     MTAIQILIDG FAISALYALG ATGFTLIFGV SGVLNLSHGA LMVTAAVVAW AASSELGLGS        60
     YAGAAVGVAV CTLLTLATYG IVVKPIDRSK AIPAEEKEIF ILTGTLLWGI MIQEFIAYLF       120
     TSNAKTVMPI VEGVVTIAGV RTPWNQIFTA VVCWGTIALL WLLVNRTRTG KVVLAASMNP       180
     RGVTLLGFEL SKIYVAIWLI YGVLAGIAGV LLGQFLGVSS YSVGPLTASA FSIVVLGGLG       240
     SVSGSLIAAY VVGYLETITA YLISPAYRTI PALLLLVAVM YVRPQGLLGR R                291
//

If you have problems or comments...

PBIL Back to PBIL home page