(data stored in ACNUC7421 zone)

EMBL: CP001349.PE64

CP001349.PE64        Location/Qualifiers
FT   CDS             72137..73063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0066"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4764 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55116"
FT                   /db_xref="GOA:B8IU71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU71"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55116.1"
FT                   /translation="MVQKLLNSPLFWLSLVGLALASVLPLWVSGYVLGLLTIAYYFGVF
FT                   SMAWDLLFGFAGEVNFGPTFLIGLGAYSAGILNGHGVSIPLCLAAGAVAAVIGGLVLAL
FT                   PALRVRGPYFGLTTVVAVLILQNFIVVFAETTGGEIGLTVPDVISVDAATNYWIALGFM
FT                   TVSGLILFAIAASPVGLILQASGQDPVEAGALGFNVAKHKLAAFCVSAFFSGLAGALLV
FT                   FYMGTASVGTLVDVSVGVQVIIGAVLGGRRTILGGVLGAVFLIAAGELLRPLGSLSTFV
FT                   VSAAALAVILFVPAGLLGILTRQGQRA"
     MVQKLLNSPL FWLSLVGLAL ASVLPLWVSG YVLGLLTIAY YFGVFSMAWD LLFGFAGEVN        60
     FGPTFLIGLG AYSAGILNGH GVSIPLCLAA GAVAAVIGGL VLALPALRVR GPYFGLTTVV       120
     AVLILQNFIV VFAETTGGEI GLTVPDVISV DAATNYWIAL GFMTVSGLIL FAIAASPVGL       180
     ILQASGQDPV EAGALGFNVA KHKLAAFCVS AFFSGLAGAL LVFYMGTASV GTLVDVSVGV       240
     QVIIGAVLGG RRTILGGVLG AVFLIAAGEL LRPLGSLSTF VVSAAALAVI LFVPAGLLGI       300
     LTRQGQRA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page