(data stored in ACNUC7421 zone)

EMBL: CP001349.PE65

CP001349.PE65        Location/Qualifiers
FT   CDS             73089..74597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0067"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_4765 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55117"
FT                   /db_xref="GOA:B8IU72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU72"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55117.1"
FT                   /translation="MTAAVLPIPPRPAPMAGRPLLAVEGLQKRYGGLVAVKSIGFTVAP
FT                   GEILGLIGPNGSGKSTVMKLIMGLERPNAGSVKLDGVEIAGWPSHRVARAGIGLVFQHS
FT                   RPLHRQTVLENIKLALLPDNLLRLFADPHVEERARAIAERVGLGAVMDRRPATLPFADL
FT                   RRMELAKAIARDPKVVLVDEPFAGLTQAEVADFSQLIRGFRDEGKAVLLVDHNVKSVAA
FT                   LVDRVFAMYLGERVAEGSATEVMRNETVRRVYLGGSIETAARPESSFSGESLLGIDNLN
FT                   VLYGKAQALQGVSLHVHEGEFVSVVGLNGAGKTTLFNAVSGLVPYTGTITYGGETLARR
FT                   SPASIARSGIVQVPESRELFGEMSVRENLDLGGQHLPKAEAARQLDWLLDLFPILRSRS
FT                   GQMARTLSGGEQQMLTIARALMMRPRLLILDEPTLGLAPVILEQLSKAMERLRQTTPIT
FT                   VLLGEQNVTFALPHADRVYVLEHARIVWEGTPDRFAAEAGTGYL"
     MTAAVLPIPP RPAPMAGRPL LAVEGLQKRY GGLVAVKSIG FTVAPGEILG LIGPNGSGKS        60
     TVMKLIMGLE RPNAGSVKLD GVEIAGWPSH RVARAGIGLV FQHSRPLHRQ TVLENIKLAL       120
     LPDNLLRLFA DPHVEERARA IAERVGLGAV MDRRPATLPF ADLRRMELAK AIARDPKVVL       180
     VDEPFAGLTQ AEVADFSQLI RGFRDEGKAV LLVDHNVKSV AALVDRVFAM YLGERVAEGS       240
     ATEVMRNETV RRVYLGGSIE TAARPESSFS GESLLGIDNL NVLYGKAQAL QGVSLHVHEG       300
     EFVSVVGLNG AGKTTLFNAV SGLVPYTGTI TYGGETLARR SPASIARSGI VQVPESRELF       360
     GEMSVRENLD LGGQHLPKAE AARQLDWLLD LFPILRSRSG QMARTLSGGE QQMLTIARAL       420
     MMRPRLLILD EPTLGLAPVI LEQLSKAMER LRQTTPITVL LGEQNVTFAL PHADRVYVLE       480
     HARIVWEGTP DRFAAEAGTG YL                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page