(data stored in ACNUC7421 zone)

EMBL: CP001349.PE66

CP001349.PE66        Location/Qualifiers
FT   CDS             complement(75039..75563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0068"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_5564 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55118"
FT                   /db_xref="GOA:B8IU73"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU73"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55118.1"
FT                   /translation="MDEEAGTVTPGPGAETIELVAGIVSAYVSNNVVPPAELPDLIAMV
FT                   SRTLGELGKSSAPAAEEIPKLTAAQIRKSITPDHIVSFIDGKPYKSMKRHLTKNGLSPD
FT                   AYRQKYGLPHDYPMVAPNYAAQRSELAKSLGLGQLRRRAMERRAESEAPAAAAGGTKKG
FT                   RGRSKEARSDR"
     MDEEAGTVTP GPGAETIELV AGIVSAYVSN NVVPPAELPD LIAMVSRTLG ELGKSSAPAA        60
     EEIPKLTAAQ IRKSITPDHI VSFIDGKPYK SMKRHLTKNG LSPDAYRQKY GLPHDYPMVA       120
     PNYAAQRSEL AKSLGLGQLR RRAMERRAES EAPAAAAGGT KKGRGRSKEA RSDR             174
//

If you have problems or comments...

PBIL Back to PBIL home page