(data stored in ACNUC7421 zone)

EMBL: CP001349.PE67

CP001349.PE67        Location/Qualifiers
FT   CDS             complement(75893..76396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mpo:Mpop_3481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55119"
FT                   /db_xref="GOA:B8IU74"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU74"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACL55119.1"
FT                   /translation="MLERIFERTLFASRWLLAPFYVALMIGLVVLLIKLAQELLHFALH
FT                   AWEAAEAQTILGVLTLVDLSFTASLLIIVMFSGYENFVSKFDHTDHKDWPEWMGTIDFT
FT                   GLKLKLMSSIVAISAIQLLKSFMDVKNNVDRDLMWLVGIHMVFVVSGLLMALTDRVVAG
FT                   HHDK"
     MLERIFERTL FASRWLLAPF YVALMIGLVV LLIKLAQELL HFALHAWEAA EAQTILGVLT        60
     LVDLSFTASL LIIVMFSGYE NFVSKFDHTD HKDWPEWMGT IDFTGLKLKL MSSIVAISAI       120
     QLLKSFMDVK NNVDRDLMWL VGIHMVFVVS GLLMALTDRV VAGHHDK                     167
//

If you have problems or comments...

PBIL Back to PBIL home page