(data stored in ACNUC7421 zone)

EMBL: CP001349.PE68

CP001349.PE68        Location/Qualifiers
FT   CDS             76656..76862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55120"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU75"
FT                   /inference="similar to AA sequence:KEGG:Mext_2797"
FT                   /protein_id="ACL55120.1"
FT                   /translation="MINAADALSRAQRAEYAAKGRSDLDRRLARLSPDERNAFWKAVNV
FT                   SYASALLPAPDLMTGRPADAAAL"
     MINAADALSR AQRAEYAAKG RSDLDRRLAR LSPDERNAFW KAVNVSYASA LLPAPDLMTG        60
     RPADAAAL                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page