(data stored in ACNUC7421 zone)

EMBL: CP001349.PE69

CP001349.PE69        Location/Qualifiers
FT   CDS             76846..77127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55121.1"
FT                   /translation="MPRPYEPHADAIRTAHAIVDDLGHKLAFAARGADPAEIENARHDL
FT                   VVRIAQAITDAEQAAIERAQDCPRPDSGPGSGMGDPYQLFLRLPSGPP"
     MPRPYEPHAD AIRTAHAIVD DLGHKLAFAA RGADPAEIEN ARHDLVVRIA QAITDAEQAA        60
     IERAQDCPRP DSGPGSGMGD PYQLFLRLPS GPP                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page