(data stored in ACNUC7421 zone)

EMBL: CP001349.PE7

CP001349.PE7         Location/Qualifiers
FT   CDS             10128..12341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0008"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: met:M446_0005
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55059"
FT                   /db_xref="GOA:B8ISZ7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ7"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACL55059.1"
FT                   /translation="MIRNDIAITPELVRQHGLTEEEYARFKGLIGREPTITELGIVSAM
FT                   WNEHCSYKSSRIHLRTLPTSAPWVIQGPGENAGVIDIGDGLACVFKMESHNHPSFIEPY
FT                   QGAATGVGGILRDVFTMGARPIAALNALRFGSPDHPRTRHLVAGVVAGIGGYGNSFGVP
FT                   TVGGSVGFHRRYDGNILVNAMAVGLARADAIFYAAATGVGNPIVYLGSKTGRDGIHGAT
FT                   MASAAFDESSEEKRPTVQVGDPFAEKLLLEACLELMASGAVIAIQDMGAAGLTCSAVEM
FT                   GAKGNLGVELNLDAVPTREPGMTAYEMMLSESQERMLMVLKPGMEEQAKAIFVKWGLDF
FT                   AIIGHTTDTLRFVIKHGGETVADLPIKELGDEAPVYDRPHRSNLYHPVLGPEEVPAPVT
FT                   NVDALRRLVGSPDLASKRWVWEQYDHFILGNTVQKPGGDAAVVRVEDGPKGLALTTDVT
FT                   PRYCEADPVEGGRQAVAEAYRNISAVGGRPLAVTDNLNFGNPERPEVMGQFVGCIHGIG
FT                   EACRALDFPVVSGNVSLYNETNGVGILPTPTIGGVGVVDDVRKTATIAFKREGDALVLI
FT                   GRTEGWLGQSLYLAEICGREEGAPPPVDLAAERRNGEFVRGLIASGLVDTVHDLSDGGL
FT                   AVALAEMAMAGGIGAALPECPLPVPCHAYLFGEDQGRYLLAVDPETLPDLLYSASAQGI
FT                   DAAVIGVTGADSLTLPGDETISVEELRGVHEAWLPNYMAGPAA"
     MIRNDIAITP ELVRQHGLTE EEYARFKGLI GREPTITELG IVSAMWNEHC SYKSSRIHLR        60
     TLPTSAPWVI QGPGENAGVI DIGDGLACVF KMESHNHPSF IEPYQGAATG VGGILRDVFT       120
     MGARPIAALN ALRFGSPDHP RTRHLVAGVV AGIGGYGNSF GVPTVGGSVG FHRRYDGNIL       180
     VNAMAVGLAR ADAIFYAAAT GVGNPIVYLG SKTGRDGIHG ATMASAAFDE SSEEKRPTVQ       240
     VGDPFAEKLL LEACLELMAS GAVIAIQDMG AAGLTCSAVE MGAKGNLGVE LNLDAVPTRE       300
     PGMTAYEMML SESQERMLMV LKPGMEEQAK AIFVKWGLDF AIIGHTTDTL RFVIKHGGET       360
     VADLPIKELG DEAPVYDRPH RSNLYHPVLG PEEVPAPVTN VDALRRLVGS PDLASKRWVW       420
     EQYDHFILGN TVQKPGGDAA VVRVEDGPKG LALTTDVTPR YCEADPVEGG RQAVAEAYRN       480
     ISAVGGRPLA VTDNLNFGNP ERPEVMGQFV GCIHGIGEAC RALDFPVVSG NVSLYNETNG       540
     VGILPTPTIG GVGVVDDVRK TATIAFKREG DALVLIGRTE GWLGQSLYLA EICGREEGAP       600
     PPVDLAAERR NGEFVRGLIA SGLVDTVHDL SDGGLAVALA EMAMAGGIGA ALPECPLPVP       660
     CHAYLFGEDQ GRYLLAVDPE TLPDLLYSAS AQGIDAAVIG VTGADSLTLP GDETISVEEL       720
     RGVHEAWLPN YMAGPAA                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page