(data stored in ACNUC7421 zone)

EMBL: CP001349.PE70

CP001349.PE70        Location/Qualifiers
FT   CDS             complement(77203..77832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0072"
FT                   /product="phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family"
FT                   /note="TIGRFAM: phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; KEGG: atc:AGR_C_2119
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55122"
FT                   /db_xref="GOA:B8IU77"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU77"
FT                   /inference="protein motif:TFAM:TIGR03308"
FT                   /protein_id="ACL55122.1"
FT                   /translation="MNDATRAPKIARTIVDETTSIRETSLGACCEILARCSIEYASIGD
FT                   YSYIGHDSIVADAEIGKFCAIAAHVRIGAPNHPIERPSLHRFTYCPEYYDAGAKRDHAF
FT                   FLRRREDRVHIGHDVWIGHGVIVLPGVRVGTGAVLAAGAVVTRDVAPYAVVAGVPARRI
FT                   RERFPPDIAERLQRIAWWDWPFSRIMEHIRDFQSDDIGRFCETWDR"
     MNDATRAPKI ARTIVDETTS IRETSLGACC EILARCSIEY ASIGDYSYIG HDSIVADAEI        60
     GKFCAIAAHV RIGAPNHPIE RPSLHRFTYC PEYYDAGAKR DHAFFLRRRE DRVHIGHDVW       120
     IGHGVIVLPG VRVGTGAVLA AGAVVTRDVA PYAVVAGVPA RRIRERFPPD IAERLQRIAW       180
     WDWPFSRIME HIRDFQSDDI GRFCETWDR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page