(data stored in ACNUC7421 zone)

EMBL: CP001349.PE72

CP001349.PE72        Location/Qualifiers
FT   CDS             complement(79282..80016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55124"
FT                   /db_xref="GOA:B8IU79"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU79"
FT                   /inference="similar to AA sequence:KEGG:M446_6153"
FT                   /protein_id="ACL55124.1"
FT                   /translation="MIRDEQIEIPVDHRRIAGTMVRPTIAAPGILFVHGWAGNQDQYLS
FT                   RARGIAALGCVCLTFDLHGHAETESDQDKVTREDNLRDIVAAYDKLAGQADVDAGAIGV
FT                   IGSSYGGYLAAILTSLRPVRWLGLRVPALYKDHDWTVPKQQLNKRELAIYRRGPVCADE
FT                   NRALGACANFRGDVLIVESEFDDVVPHPVIVNYRDAFDRARSVTYRVIAGADHALSEPP
FT                   WQEAYTSLLVNWAEELIIGARE"
     MIRDEQIEIP VDHRRIAGTM VRPTIAAPGI LFVHGWAGNQ DQYLSRARGI AALGCVCLTF        60
     DLHGHAETES DQDKVTREDN LRDIVAAYDK LAGQADVDAG AIGVIGSSYG GYLAAILTSL       120
     RPVRWLGLRV PALYKDHDWT VPKQQLNKRE LAIYRRGPVC ADENRALGAC ANFRGDVLIV       180
     ESEFDDVVPH PVIVNYRDAF DRARSVTYRV IAGADHALSE PPWQEAYTSL LVNWAEELII       240
     GARE                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page