(data stored in ACNUC7421 zone)

EMBL: CP001349.PE73

CP001349.PE73        Location/Qualifiers
FT   CDS             complement(80003..81148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0075"
FT                   /product="biotin carboxylase"
FT                   /note="KEGG: met:M446_6154 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55125"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU80"
FT                   /inference="similar to AA sequence:KEGG:M446_6154"
FT                   /protein_id="ACL55125.1"
FT                   /translation="MPQQARPHLHQPAPNGVVVVLTAADGGLSSLHERMTRTEIAKRLA
FT                   GLMNFEFGGEYDAGTRYPGRLYFVPSRTLVGLETAQSLGIRGEQDLFGGVVPHAFVATK
FT                   AITQPLVTPDACAPPGWNRAFGDAVQNLVLAGFSVFTREDARRAAETLLRCGRVRLKPV
FT                   LATGGRGQVLLSDLAELETALEAVDPDELSSCGLVLEENLTGTTTYSVGQVRSCNLLVT
FT                   YYGTQRVTTDNSGREVYGGSTLVVVRDGFEALLALDIPKLARIAIRQAQAYDSAAWAHF
FT                   PGLLVSRRNYDVIQGLDARGRWRSGVLEQSWRLGGASAAEIAALEAFAGDPGLRVVRAS
FT                   CVEIYGDSKDPPTDSITLFRGVDDEVGFISKYAMVDLHDTG"
     MPQQARPHLH QPAPNGVVVV LTAADGGLSS LHERMTRTEI AKRLAGLMNF EFGGEYDAGT        60
     RYPGRLYFVP SRTLVGLETA QSLGIRGEQD LFGGVVPHAF VATKAITQPL VTPDACAPPG       120
     WNRAFGDAVQ NLVLAGFSVF TREDARRAAE TLLRCGRVRL KPVLATGGRG QVLLSDLAEL       180
     ETALEAVDPD ELSSCGLVLE ENLTGTTTYS VGQVRSCNLL VTYYGTQRVT TDNSGREVYG       240
     GSTLVVVRDG FEALLALDIP KLARIAIRQA QAYDSAAWAH FPGLLVSRRN YDVIQGLDAR       300
     GRWRSGVLEQ SWRLGGASAA EIAALEAFAG DPGLRVVRAS CVEIYGDSKD PPTDSITLFR       360
     GVDDEVGFIS KYAMVDLHDT G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page