(data stored in ACNUC7421 zone)

EMBL: CP001349.PE74

CP001349.PE74        Location/Qualifiers
FT   CDS             complement(81266..81772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55126"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU81"
FT                   /inference="similar to AA sequence:KEGG:SMc01448"
FT                   /protein_id="ACL55126.1"
FT                   /translation="MSATGLAVFDKTLQITHIWLDELMAELGPDREVAWHVLGVVLRRI
FT                   RDRVPLELAAHLGAQLPLLVRGHYYDQWRPGHQPERSRSLDEFLDGIAAGLANTRPVNV
FT                   QAASQAVFGVLSRHVDRGQVDKVRAALPEEVRLLWPHEPDAPGISILEDEPGATPYPSV
FT                   GADRG"
     MSATGLAVFD KTLQITHIWL DELMAELGPD REVAWHVLGV VLRRIRDRVP LELAAHLGAQ        60
     LPLLVRGHYY DQWRPGHQPE RSRSLDEFLD GIAAGLANTR PVNVQAASQA VFGVLSRHVD       120
     RGQVDKVRAA LPEEVRLLWP HEPDAPGISI LEDEPGATPY PSVGADRG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page