(data stored in ACNUC7421 zone)

EMBL: CP001349.PE76

CP001349.PE76        Location/Qualifiers
FT   CDS             complement(83111..84526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0078"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL120502 putative guanylate/adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55128"
FT                   /db_xref="GOA:B8IU83"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU83"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55128.1"
FT                   /translation="MMHDSDALLDALRQAGDPEAVQALEQLIQHGADEELVRINALSFA
FT                   GEHGLSQDAVISTLLHGARLGLFEMSWNILCSSCGGVLGANASLKSVRQDAYRCAFCAL
FT                   DTEPILDDAVEVSFAISPRIRRVAAHDPGSLAFWDYHRQIFFGTGVVFPEPPAFEDLAR
FT                   LATLEAVELQAGERMILALQIPAGSLILFDPVTHTAQVLDVAGEPAQQRQELSLVFDDI
FT                   RPAVGHVDLKPGQLRLTLENRSEERVLPGIFIAGEALNTLIGGRRPFLTAKRLLSNQAF
FT                   RDIYRTDALDVDQRLKILSLTFVFTDLTGSTDLYERVGDLVAYDLVRSHFQILTAVVAS
FT                   HGGAVVKTIGDAVMATFPMPSQAVAAALEMREAMRRLNTGRETDELILKIGLHEGPCLA
FT                   VLLNDRQDYFGQTVNIAARVQELATSGAIFVSEPVVRHAEAARLLTEKGLQAQRHLCSL
FT                   RGIGSRMPVFELT"
     MMHDSDALLD ALRQAGDPEA VQALEQLIQH GADEELVRIN ALSFAGEHGL SQDAVISTLL        60
     HGARLGLFEM SWNILCSSCG GVLGANASLK SVRQDAYRCA FCALDTEPIL DDAVEVSFAI       120
     SPRIRRVAAH DPGSLAFWDY HRQIFFGTGV VFPEPPAFED LARLATLEAV ELQAGERMIL       180
     ALQIPAGSLI LFDPVTHTAQ VLDVAGEPAQ QRQELSLVFD DIRPAVGHVD LKPGQLRLTL       240
     ENRSEERVLP GIFIAGEALN TLIGGRRPFL TAKRLLSNQA FRDIYRTDAL DVDQRLKILS       300
     LTFVFTDLTG STDLYERVGD LVAYDLVRSH FQILTAVVAS HGGAVVKTIG DAVMATFPMP       360
     SQAVAAALEM REAMRRLNTG RETDELILKI GLHEGPCLAV LLNDRQDYFG QTVNIAARVQ       420
     ELATSGAIFV SEPVVRHAEA ARLLTEKGLQ AQRHLCSLRG IGSRMPVFEL T                471
//

If you have problems or comments...

PBIL Back to PBIL home page