(data stored in ACNUC7421 zone)

EMBL: CP001349.PE77

CP001349.PE77        Location/Qualifiers
FT   CDS             85171..86010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0079"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   met:M446_2090 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55129"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU84"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACL55129.1"
FT                   /translation="MTRDGHRSSVSSQPRPASGWRRIARSLALLVSLSTSSTMVLAYAD
FT                   LLPQVMEQEILASPAGGLPHLTRRLAQQGAPLRIVAFGSSSTEGVGASSPAAAYPARLE
FT                   AALRRALPRLAGGITVLNRGIGGEHADDMLGRLERDVLAARPDLVIWQTGSNDPLRGVS
FT                   LEHFREATVAGVRRMQAAGSDVVLMEPQWCPKLDATPDAYRFRDMVREIGAELGVPVIR
FT                   RSDLMRDWIAGGRLTREELFAPDGLHMADRGYDLLGQAVARDILRRAQPVVMAQAGE"
     MTRDGHRSSV SSQPRPASGW RRIARSLALL VSLSTSSTMV LAYADLLPQV MEQEILASPA        60
     GGLPHLTRRL AQQGAPLRIV AFGSSSTEGV GASSPAAAYP ARLEAALRRA LPRLAGGITV       120
     LNRGIGGEHA DDMLGRLERD VLAARPDLVI WQTGSNDPLR GVSLEHFREA TVAGVRRMQA       180
     AGSDVVLMEP QWCPKLDATP DAYRFRDMVR EIGAELGVPV IRRSDLMRDW IAGGRLTREE       240
     LFAPDGLHMA DRGYDLLGQA VARDILRRAQ PVVMAQAGE                              279
//

If you have problems or comments...

PBIL Back to PBIL home page