(data stored in ACNUC7421 zone)

EMBL: CP001349.PE78

CP001349.PE78        Location/Qualifiers
FT   CDS             complement(86372..86647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55130"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU85"
FT                   /inference="similar to AA sequence:KEGG:M446_6371"
FT                   /protein_id="ACL55130.1"
FT                   /translation="MPRYYFDVLSRSGLVCQDFQGLECRDDAAALAVARHGAGFTSHDD
FT                   CARNPQLTHYLFSVADAAHRPLFTVPFTELEPDQSQAPRRRRGAAH"
     MPRYYFDVLS RSGLVCQDFQ GLECRDDAAA LAVARHGAGF TSHDDCARNP QLTHYLFSVA        60
     DAAHRPLFTV PFTELEPDQS QAPRRRRGAA H                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page