(data stored in ACNUC7421 zone)

EMBL: CP001349.PE79

CP001349.PE79        Location/Qualifiers
FT   CDS             87265..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG04830"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55131"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55131.1"
FT                   /translation="MAVAQHTDQSKKTEQIRRIADPAQESVDRAAETGSEAVNLAKENL
FT                   SRVSDLRDRAADNALQVVQMSVETIARNTRELNDQITRTFGFGSEDSERLADQSRQNAE
FT                   AIARCGTVLTQAVQDAFRNSFELGQKRWQSNLDGLNKLTRARSVHELAMLQSEVARESL
FT                   QNLVQDTRTVAESSLRAFEEASRICASVKPLAQIR"
     MAVAQHTDQS KKTEQIRRIA DPAQESVDRA AETGSEAVNL AKENLSRVSD LRDRAADNAL        60
     QVVQMSVETI ARNTRELNDQ ITRTFGFGSE DSERLADQSR QNAEAIARCG TVLTQAVQDA       120
     FRNSFELGQK RWQSNLDGLN KLTRARSVHE LAMLQSEVAR ESLQNLVQDT RTVAESSLRA       180
     FEEASRICAS VKPLAQIR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page