(data stored in ACNUC7421 zone)

EMBL: CP001349.PE80

CP001349.PE80        Location/Qualifiers
FT   CDS             89014..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55132"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU87"
FT                   /inference="similar to AA sequence:KEGG:M446_3764"
FT                   /protein_id="ACL55132.1"
FT                   /translation="MDRRLALTALASAFAIPSFIGAAFAQNEPSSASKSTGNTGARMGE
FT                   AEAKHAADTLAAGSLALAASRIALKKAKDDDVKQFAQFEVAEQETIADVLKAMRDPSTP
FT                   ASGQVKAPSEPEVTGQIDSRGKATLDKLEQAKAGPAFDAEYIKGQIEGHQSLLKIQEDY
FT                   LATGKDRENLGAAKLARGMIKEHLALLSDIKKDLKE"
     MDRRLALTAL ASAFAIPSFI GAAFAQNEPS SASKSTGNTG ARMGEAEAKH AADTLAAGSL        60
     ALAASRIALK KAKDDDVKQF AQFEVAEQET IADVLKAMRD PSTPASGQVK APSEPEVTGQ       120
     IDSRGKATLD KLEQAKAGPA FDAEYIKGQI EGHQSLLKIQ EDYLATGKDR ENLGAAKLAR       180
     GMIKEHLALL SDIKKDLKE                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page